Home > Product > Antimicrobial Peptides > Cecropin-A

Antimicrobial Peptides

Cecropin-A

[Price Inquiry]
CAT#
AF2646
Sequence
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
Host Chemicals
Hyalophora cecropia
Length
37
Activity
Antibacterial
SwissProt ID
P01507
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.