Home > Product > Catalog Peptides > Others > Cecropin A

Others

Cecropin A

Price Inquiry
CAT#
C13001
Sequence
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
M.W/Mr.
4003.84
Molecular Formula
C184H313N53O46
Length
37

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.