Home > Product > Catalog Peptides > Others > Cecropin A

Others

warning All products are for research use only. Not for human use.

Cecropin A

[Price Inquiry]
CAT#
C13001
Sequence
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
M.W/Mr.
4003.84
Molecular Formula
C184H313N53O46
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.