Home > Product > Antimicrobial Peptides > Cecropin A1

Antimicrobial Peptides

Cecropin A1

[Price Inquiry]
CAT#
AF2464
Sequence
RWKLFKKIEKVGRNVRDGLIKAGPAIAVIGQAKSL
Host Chemicals
Bombyx mori
Length
35
Activity
Antibacterial
SwissProt ID
Q27239
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.