Home > Product > Antimicrobial Peptides > Cecropin-B

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cecropin-B

[Price Inquiry]
CAT#
AF2274
Sequence
KWKVFKKIEKVGRNIRDGIVKAGPAIAVLGQAN
Host Chemicals
Heliothis virescens
Length
33
Activity
Antibacterial, Antifungal
SwissProt ID
P83414
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.