Home > Product > Antimicrobial Peptides > Cecropin-B

Antimicrobial Peptides

Cecropin-B

[Price Inquiry]
CAT#
AF2338
Sequence
APRWKFGKRLEKLGRNVFRAAKKALPVIAGYKAL
Host Chemicals
Anopheles gambiae
Length
34
Activity
Antibacterial
SwissProt ID
Q8MUF4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.