Home > Product > Antimicrobial Peptides > Cecropin-B

Antimicrobial Peptides

Cecropin-B

Price Inquiry
CAT#
AF2428
Sequence
KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL
Host Chemicals
Antheraea pernyi
Length
35
Activity
Antibacterial
SwissProt ID
P01509

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.