Home > Product > Antimicrobial Peptides > Cecropin B

Antimicrobial Peptides

Cecropin B

[Price Inquiry]
CAT#
AF2647
Sequence
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAILS
Host Chemicals
Hyalophora cecropia
Length
37
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.