Home > Product > Antimicrobial Peptides > Cecropin-B

Antimicrobial Peptides

Cecropin-B

[Price Inquiry]
CAT#
AF2675
Sequence
RWKVFKKIEKMGRNIRDGIVKAGPAIEVLGSAKALGK
Host Chemicals
Spodoptera litura
Length
37
Activity
Antibacterial
SwissProt ID
Q9XZH0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.