Home > Product > Antimicrobial Peptides > Cecropin B1

Antimicrobial Peptides

Cecropin B1

[Price Inquiry]
CAT#
AF2461
Sequence
RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAI
Host Chemicals
Bombyx mori
Length
35
Activity
Antibacterial
SwissProt ID
P04142
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.