CAT# | AF2461 |
Sequence | RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAI |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...
Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
GIP is a 42-aminoacid peptide secreted from the intestinal K-cells (located mainly in the duodenum and proximal jejunum) and ...