Home > Product > Antimicrobial Peptides > Cecropin-C

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cecropin-C

[Price Inquiry]
CAT#
AF2282
Sequence
RWKVFKKIEKMGRNIRDGVIKAAPAIEVLGQAK
Host Chemicals
Heliothis virescens
Length
33
Activity
Antibacterial, Antifungal
SwissProt ID
P83415
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.