Home > Product > Antimicrobial Peptides > Cecropin-D

Antimicrobial Peptides

Cecropin-D

[Price Inquiry]
CAT#
AF2551
Sequence
WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK
Host Chemicals
Hyalophora cecropia
Length
36
Activity
Antibacterial, Antifungal
SwissProt ID
P01510
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.