Home > Product > Antimicrobial Peptides > Cecropin-D-like peptide

Antimicrobial Peptides

Cecropin-D-like peptide

[Price Inquiry]
CAT#
AF2764
Sequence
ENFFKEIERAGQRIRDAIISAAPAVETLAQAQKIIKGGD
Host Chemicals
Galleria mellonella
Length
39
Activity
Antibacterial, Antifungal
SwissProt ID
P85210
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.