Home > Product > Antimicrobial Peptides > Cecropin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2167
Sequence
WKPFKKIEKAVRRVRDGVAKAGPAVAVVGQAT
Host Chemicals
Oiketicus kirbyi
Length
32
Activity
Antibacterial, Antifungal
SwissProt ID
P83420
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.