Home > Product > Antimicrobial Peptides > Cecropin P2

Antimicrobial Peptides

Cecropin P2

[Price Inquiry]
CAT#
AF2068
Sequence
SWLSKTYKKLENSAKKRISEGIAIAIQGGPR
Host Chemicals
Ascaris suum
Length
31
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.