Home > Product > Antimicrobial Peptides > Centrocin 1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Centrocin 1

[Price Inquiry]
CAT#
AF1953
Sequence
GWFKKTFHKVSHAVKSGIHAGQRGCSALGF
Host Chemicals
Strongylocentrotus droebachiensis
Length
30
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.