Home > Product > Antimicrobial Peptides > Chain A, Hevein-Type Antifungal Peptide With A Unique 10-Cysteine Motif

Antimicrobial Peptides

Chain A, Hevein-Type Antifungal Peptide With A Unique 10-Cysteine Motif

[Price Inquiry]
CAT#
AF3026
Sequence
QRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
Host Chemicals
Triticum kiharae
Length
43
Activity
Antibacterial, Antifungal
SwissProt ID
P85966
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.