Chain A, Hevein-Type Antifungal Peptide With A Unique 10-Cysteine Motif

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3026
Sequence	QRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF1797	Viba 15	Inquiry
AF2988	Human drosomycin-like defensin	Inquiry
AF424	Gramicidin B	Inquiry
AF2635	Lividin-4	Inquiry
AF2550	Paenicidin A	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

A brief review of Octreotide

Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...

Huwentoxin IV, A Kind of Selective NaV1.7 Channel Blocker

Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...

The source and function of tripeptide-1 kollaren

of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...

A Cellular Gβγ Antagonist, GRK2i

GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...

Function of myristoyl pentapeptide-8 in skin and eyelash

Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Triticum kiharae
Length	43
SwissProt ID	P85966