Home > Product > Antimicrobial Peptides > Chensinin-3CE

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Chensinin-3CE

[Price Inquiry]
CAT#
AF3140
Sequence
FTLKKSQLLLFFLGTINFSLCEEERNAEEERRDYPEEKDVEVEKR
Host Chemicals
Rana chensinensis
Length
45
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.