Home > Product > Antimicrobial Peptides > Chicken AvBD4

Antimicrobial Peptides

Chicken AvBD4

Price Inquiry
CAT#
AF2748
Sequence
RYHMQCGYRGTFCTPGKCPYGNAYLGLCRPKYSCCRWL
Host Chemicals
Gallus gallus domestic
Length
38
Activity
Antibacterial

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.