Home > Product > Antimicrobial Peptides > Chicken AvBD4

Antimicrobial Peptides

Chicken AvBD4

[Price Inquiry]
CAT#
AF2748
Sequence
RYHMQCGYRGTFCTPGKCPYGNAYLGLCRPKYSCCRWL
Host Chemicals
Gallus gallus domestic
Length
38
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.