Home > Product > Antimicrobial Peptides > Chicken AvBD7

Antimicrobial Peptides

Chicken AvBD7

[Price Inquiry]
CAT#
AF3229
Sequence
QPFIPRPIDTCRLRNGICFPGICRRPYYWIGTCNNGIGSCCARGWRS
Host Chemicals
Gallus gallus
Length
47
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.