Keywords Search Google Search Search

Chlorotoxin (Cltx).

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	T09029
M.W/Mr.	3996
Sequence	MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2

CAT#	Product Name	Inquiry
H2605	Hippuryl-Lys-Val-OH	Inquiry
T05062	H-Phe-Pro-Arg-OH	Inquiry
X21206	Human PD-L1 inhibitor II	Inquiry
CP25619	H-L-Tyr(PO3H2)-OH	Inquiry
X21210	Nuclear Factor (Erythroid-derived 2) like 2 (74 - 87)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

KAI-1678: A novel PKC-epsilon inhibitor

KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...

The Amyloid Precursor Protein and Alzheimer's Disease

The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...

The Function of Deslorelin Acetate in Advanced Prostate Cancer

Deslorelin acetate, marketed under the trade names Ovuplant, SucroMate and Suprelorin, is an injectable gonadotr ...

What is Glutathione?

Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...

Function of M871 as a Galanin GAL2 Receptor Antagonist

Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	36
Modifications	disulfide