Various Products / Cancer Research

Chlorotoxin (Cltx).

Price Inquiry
CAT#
T09029
Sequence
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2
M.W/Mr.
3996
Modifications
disulfide
Length
36

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.