Home > Product > Catalog Peptides > Others > Chlorotoxin (Cltx).

Others

warning All products are for research use only. Not for human use.

Chlorotoxin (Cltx).

[Price Inquiry]
CAT#
T09029
Sequence
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2
M.W/Mr.
3996
Modifications
disulfide
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.