Home > Product > Antimicrobial Peptides > Circulin-A

Antimicrobial Peptides

Circulin-A

[Price Inquiry]
CAT#
AF1920
Sequence
GIPCGESCVWIPCISAALGCSCKNKVCYRN
Host Chemicals
Chassalia parviflora
Length
30
Activity
Antibacterial, Antifungal
SwissProt ID
P56871
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.