CAT# | AF1920 |
Sequence | GIPCGESCVWIPCISAALGCSCKNKVCYRN |
Activity | Antibacterial, Antifungal |
Host Chemicals | Chassalia parviflora | Length | 30 | SwissProt ID | P56871 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1427 | Maximin-y | Inquiry | ||
AF1043 | Maximin 68 | Inquiry | ||
AF1430 | Maximin 41 | Inquiry | ||
AF155 | Curvalicin-28a | Inquiry | ||
AF1623 | Ranatuerin-2PLf | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. TMEM16F and dynamins control expansive plasma membrane reservoirs
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...