Home > Product > Antimicrobial Peptides > Circulin-B

Antimicrobial Peptides

Circulin-B

[Price Inquiry]
CAT#
AF2044
Sequence
GVIPCGESCVFIPCISTLLGCSCKNKVCYRN
Host Chemicals
Chassalia parviflora
Length
31
Activity
Antibacterial
SwissProt ID
P56879
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.