Home > Product > Antimicrobial Peptides > Circulin-C

Antimicrobial Peptides

Circulin-C

[Price Inquiry]
CAT#
AF1882
Sequence
CGESCVFIPCITSVAGCSCKSKVCYRNGIP
Host Chemicals
Chassalia parviflora
Length
30
Activity
Antiviral
SwissProt ID
P84641
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.