Home > Product > Antimicrobial Peptides > Circulin C

Antimicrobial Peptides

Circulin C

[Price Inquiry]
CAT#
AF1915
Sequence
GIPCGESCVFIPCITSVAGCSCKSKVCYRN
Host Chemicals
Chassalia parvifolia
Length
30
Activity
Antiviral
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.