Home > Product > Antimicrobial Peptides > Circulin-D

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Circulin-D

[Price Inquiry]
CAT#
AF1962
Sequence
KIPCGESCVWIPCVTSIFNCKCENKVCYHD
Host Chemicals
Chassalia parviflora
Length
30
Activity
Antiviral
SwissProt ID
P84642
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.