Home > Product > Antimicrobial Peptides > Circulin D

Antimicrobial Peptides

Circulin D

[Price Inquiry]
CAT#
AF2050
Sequence
KIPCGESCVWIPCVTSIFNCKCKENKVCYHD
Host Chemicals
Chassalia parvifolia
Length
31
Activity
Antiviral
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.