Home > Product > Antimicrobial Peptides > Circulin-E

Antimicrobial Peptides

Circulin-E

[Price Inquiry]
CAT#
AF1961
Sequence
KIPCGESCVWIPCLTSVFNCKCENKVCYHD
Host Chemicals
Chassalia parviflora
Length
30
Activity
Antiviral
SwissProt ID
P84643
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.