Home > Product > Antimicrobial Peptides > Circulin-E

Antimicrobial Peptides

Circulin-E

Price Inquiry
CAT#
AF1961
Sequence
KIPCGESCVWIPCLTSVFNCKCENKVCYHD
Host Chemicals
Chassalia parviflora
Length
30
Activity
Antiviral
SwissProt ID
P84643

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.