Home > Product > Antimicrobial Peptides > Cliotide T2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cliotide T2

[Price Inquiry]
CAT#
AF1896
Sequence
GEFLKCGESCVQGECYTPGCSCDWPICKKN
Host Chemicals
Clitoria ternatea
Length
30
Activity
Cancer cells
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.