Home > Product > Antimicrobial Peptides > Cliotide T4

Antimicrobial Peptides

Cliotide T4

[Price Inquiry]
CAT#
AF1913
Sequence
GIPCGESCVFIPCITAAIGCSCKSKVCYRN
Host Chemicals
Clitoria ternatea
Length
30
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.