Home > Product > Catalog Peptides > Others > Cobrotoxin

Others

Cobrotoxin

[Price Inquiry]
CAT#
N10005
Sequence
LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
Modifications
Disulfide bond(4)
Length
62
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.