Home > Product > Catalog Peptides > Others > Copeptin (human)

Others

Copeptin (human)

[Price Inquiry]
CAT#
C28001
Sequence
ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
M.W/Mr.
4021.46
Molecular Formula
C177H279N49O58
Length
39
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.