Home > Product > Catalog Peptides > Others > Corticotropin Releasing Factor, CRF, human, rat

Others

Corticotropin Releasing Factor, CRF, human, rat

Price Inquiry
CAT#
C29001
Sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIICONH
M.W/Mr.
4757.5
Length
45

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.