Home > Product > Catalog Peptides > Others > Corticotropin Releasing Factor, CRF, human, rat

Others

Corticotropin Releasing Factor, CRF, human, rat

[Price Inquiry]
CAT#
C29001
Sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIICONH
M.W/Mr.
4757.5
Length
45
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.