Home > Product > Catalog Peptides > Others > Corticotropin Releasing Factor, porcine

Others

Corticotropin Releasing Factor, porcine

Price Inquiry
CAT#
C29016
Sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMENF-NH2
M.W/Mr.
4792.6
Molecular Formula
C209H337N61O64S2
Length
41

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.