Home > Product > Antimicrobial Peptides > Cp-thionin II

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cp-thionin II

[Price Inquiry]
CAT#
AF3209
Sequence
KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC
Host Chemicals
cowpea seeds, Vigna unguiculata
Length
46
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.