Home > Product > Catalog Peptides > Others > CRF (bovine)

Others

CRF (bovine)

[Price Inquiry]
CAT#
C29015
Sequence
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2
M.W/Mr.
4697.40
Molecular Formula
C206H340N60O63S
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.