Home > Product > Catalog Peptides > Others > CRF (ovine)

Others

CRF (ovine)

Price Inquiry
CAT#
C29014
Sequence
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
M.W/Mr.
4670.37
Molecular Formula
C205H339N59O63S
Length
41

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.