Home > Product > Catalog Peptides > Others > CRF (ovine)

Others

CRF (ovine)

[Price Inquiry]
CAT#
C29014
Sequence
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
M.W/Mr.
4670.37
Molecular Formula
C205H339N59O63S
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.