Home > Product > Antimicrobial Peptides > Cryptdin related sequence peptide

Antimicrobial Peptides

Cryptdin related sequence peptide

[Price Inquiry]
CAT#
AF2738
Sequence
LQDAAVGWGRRCPQCPRCPSCPSCPRCPRCPRCKCNPK
Host Chemicals
Mus musculus
Length
38
Activity
Antimicrobial
SwissProt ID
Q70LV9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.