Home > Product > Antimicrobial Peptides > Ct-AMP1

Antimicrobial Peptides

CAT#
AF3255
Sequence
NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFDC
Host Chemicals
Clitoria ternatea
Length
49
Activity
Gram+, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.