CAT# | AF2409 |
Sequence | GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQME |
Activity | Antibacterial |
Host Chemicals | Cupiennius salei | Length | 35 | SwissProt ID | P83620 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF988 | Scolopendrasin II | Inquiry | ||
AF3329 | Ubiquicidin | Inquiry | ||
AF2681 | PBD-1 | Inquiry | ||
AF1252 | Brevinin-1P | Inquiry | ||
AF1795 | Vibi B | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...
KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...
MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...
APC 366 [N-(1-hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide], is a novel selective inhibitor of mast cell tryptas ...