Home > Product > Antimicrobial Peptides > Cupiennin-1b

Antimicrobial Peptides

Cupiennin-1b

[Price Inquiry]
CAT#
AF2409
Sequence
GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQME
Host Chemicals
Cupiennius salei
Length
35
Activity
Antibacterial
SwissProt ID
P83620
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.