Home > Product > Antimicrobial Peptides > Cupiennin-1c

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cupiennin-1c

[Price Inquiry]
CAT#
AF2410
Sequence
GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQTE
Host Chemicals
Cupiennius salei
Length
35
Activity
Antibacterial
SwissProt ID
P83621
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.