Home > Product > Antimicrobial Peptides > Cupiennin-1d

Antimicrobial Peptides

Cupiennin-1d

[Price Inquiry]
CAT#
AF2411
Sequence
GFGSLFKFLAKKVAKTVAKQAAKQGAKYVANKHME
Host Chemicals
Cupiennius salei
Length
35
Activity
Antibacterial
SwissProt ID
P83622
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.