Keywords Search Google Search Search

Curvaticin

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF1881
Sequence	AYPGNGVHCGKYSCTVDKQTAIGNIGNNAA
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF682	Phylloseptin-13	Inquiry
AF460	Aurein-2.3	Inquiry
AF1586	Hyfl O	Inquiry
AF584	Rhesus theta defensin-1/3, subunit A precursor	Inquiry
AF2145	Oral Mucosal Alpha-Defensin	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of a vasoactive peptide Endothelin-1

Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...

Aclerastide [DSC127] as a Therapy for the Treatment of Diabetic Foot Ulcers

Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...

Orexin Peptides

Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...

Function of Abarelix in Advanced Prostate Cancer

Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...

Function of NoxA1ds in Colon Cancer

NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Lactobacillus curvatus
Length	30
SwissProt ID	P84886