Home > Product > Antimicrobial Peptides > Curvaticin

Antimicrobial Peptides

Curvaticin

[Price Inquiry]
CAT#
AF1881
Sequence
AYPGNGVHCGKYSCTVDKQTAIGNIGNNAA
Host Chemicals
Lactobacillus curvatus
Length
30
Activity
Antibacterial
SwissProt ID
P84886
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.