CAT# | AF2060 |
Sequence | SIPCGESCVFIPCTVTALLGCSCKSKVCYKN |
Activity | Antibacterial |
Host Chemicals | Psychotria longipes | Length | 31 | SwissProt ID | P56872 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1369 | Grammistin Pp4a | Inquiry | ||
AF3304 | CATH_BRALE | Inquiry | ||
AF1942 | Thuricin CD | Inquiry | ||
AF1604 | Bombinin-like peptide 7, BPL-7 | Inquiry | ||
AF3282 | Aureocin A53 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...
Compstatin is a 13-residue cyclic peptide (Ile1-Cys2-Val3-Val4-Gln5-Asp6-Trp7-Gly8-His9-His10-Arg11-Cys12-Thr13- ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...