Home > Product > Antimicrobial Peptides > Cyclopsychotride-A

Antimicrobial Peptides

Cyclopsychotride-A

[Price Inquiry]
CAT#
AF2060
Sequence
SIPCGESCVFIPCTVTALLGCSCKSKVCYKN
Host Chemicals
Psychotria longipes
Length
31
Activity
Antibacterial
SwissProt ID
P56872
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.