Home > Product > Antimicrobial Peptides > Cycloviolacin O13

Antimicrobial Peptides

Cycloviolacin O13

[Price Inquiry]
CAT#
AF1919
Sequence
GIPCGESCVWIPCISAAIGCSCKSKVCYRN
Host Chemicals
Viola odorata
Length
30
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.