Home > Product > Antimicrobial Peptides > Cycloviolacin O17

Antimicrobial Peptides

Cycloviolacin O17

[Price Inquiry]
CAT#
AF1918
Sequence
GIPCGESCVWIPCISAAIGCSCKNKVCYRN
Host Chemicals
Viola odorata
Length
30
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.