CAT# | AF1921 |
Sequence | GIPCGESCVWIPCISSAIGCSCKSKVCYRN |
Activity | Antimicrobial, Anticancer |
Host Chemicals | Viola odorata | Length | 30 | SwissProt ID | P58434 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3343 | CAP-18, rabbit | Inquiry | ||
AF3322 | Gassericin A | Inquiry | ||
AF3079 | ENAP-1 | Inquiry | ||
AF661 | PCM19 | Inquiry | ||
AF1692 | Ranatuerin-2SEC | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...
Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...
Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
The peptide Difopein, designed, isolated and identified by Haian Fu, is a high affinity inhibitor of 14-3-3 pro ...