Home > Product > Antimicrobial Peptides > Cycloviolacin-O2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cycloviolacin-O2

[Price Inquiry]
CAT#
AF1921
Sequence
GIPCGESCVWIPCISSAIGCSCKSKVCYRN
Host Chemicals
Viola odorata
Length
30
Activity
Antimicrobial, Anticancer
SwissProt ID
P58434
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.