Keywords Search Google Search Search

Cycloviolacin-O2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF1921
Sequence	GIPCGESCVWIPCISSAIGCSCKSKVCYRN
Activity	Antimicrobial, Anticancer

CAT#	Product Name	Inquiry
AF3343	CAP-18, rabbit	Inquiry
AF3322	Gassericin A	Inquiry
AF3079	ENAP-1	Inquiry
AF661	PCM19	Inquiry
AF1692	Ranatuerin-2SEC	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Mechanism of Acetyl Tetrapeptide-22

The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...

Function of pergolide mesylate salt in Parkinson's disease

Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...

Glucagon and Glucagon signaling

Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...

Function of PM102 for the reversal of heparin anticoagulation

PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...

Difopein, a high affinity inhibitor of 14-3-3 proteins

The peptide Difopein, designed, isolated and identified by Haian Fu, is a high affinity inhibitor of 14-3-3 pro ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Viola odorata
Length	30
SwissProt ID	P58434