Home > Product > Antimicrobial Peptides > Cycloviolin-A

Antimicrobial Peptides

Cycloviolin-A

[Price Inquiry]
CAT#
AF2042
Sequence
GVIPCGESCVFIPCISAAIGCSCKNKVCYRN
Host Chemicals
Leonia cymosa
Length
31
Activity
Antiviral
SwissProt ID
P84637
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.