Home > Product > Antimicrobial Peptides > Cycloviolin-C

Antimicrobial Peptides

Cycloviolin-C

[Price Inquiry]
CAT#
AF1917
Sequence
GIPCGESCVFIPCLTTVAGCSCKNKVCYRN
Host Chemicals
Leonia cymosa
Length
30
Activity
Antiviral
SwissProt ID
P84639
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.