Home > Product > Antimicrobial Peptides > Cycloviolin-D

Antimicrobial Peptides

Cycloviolin-D

[Price Inquiry]
CAT#
AF1899
Sequence
GFPCGESCVFIPCISAAIGCSCKNKVCYRN
Host Chemicals
Leonia cymosa
Length
30
Activity
Antiviral
SwissProt ID
P84640
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.