Keywords Search Google Search Search

Cys-LC-LL-37

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	L07004
M.W/Mr.	4709.7
Sequence	CLCLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

CAT#	Product Name	Inquiry
L07005	Biotinyl-LL-37 amide	Inquiry
L07008	LL-37 amide	Inquiry
L07002	LL-37, reverse sequence	Inquiry
L07006	KR-12 (human)	Inquiry
L07001	LL-37, Antimicrobial Peptide, human	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Aclerastide [DSC127] as a Therapy for the Treatment of Diabetic Foot Ulcers

Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...

The mechanism of R18 on 14-3-3 protein

R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...

The Function of Cyclosporin A as an Immunosuppressant

Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...

KAI-1455: A selective ε-protein kinase C activator

KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...

Function of carnosine in skin, food and body

Carnosine (β-alanyl-l-histidine), containing an imidazole moiety, is an intramuscular dipeptide consisting of β ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: