Home > Product > Catalog Peptides > Others > Cys-LC-LL-37

Others

Cys-LC-LL-37

[Price Inquiry]
CAT#
L07004
Sequence
CLCLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
M.W/Mr.
4709.7
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.